DPCstruct | MC43178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 391 |
|---|---|
| Mean domain length (aa) | 177 ± 31 aa |
| Standard deviation of domain lengths | 30.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.27 |
| Pfam Score | 63.89 |
| Assigned Pfam label(s) | CL0023- PF08353- PF02875 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6XJ02 | 13-185 | RQNAGVALAAVELAGYSRAEAARVLGEFRGATRRLELRGQVGGVDVVDSYAHHPRELAADIAAARDGGRVLALFQPHLYSRTRHLAR… |
| A0A843F732 | 5-149 | RRFAKLNDEPLIIDDFAHNPDGIKNTIKETIKLVNGSQKLHVVCAIRGSRGVEINQLNVEALVEVLNEDINLFLSSSNDVVNDLNYV… |
| A0A199VI59 | 606-885 | None |
| K1V166 | 47-182 | None |
| A0A2H0BFP3 | 260-440 | None |
| A0A1V5FPT7 | 464-660 | None |
| A0A1V5UV84 | 237-411 | None |
| A0A2M7UDM9 | 29-211 | None |
| A0A2U2BQH3 | 837-1020 | None |
| A0A447TMI9 | 26-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.