DPCstruct | MC43177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 224 ± 50 aa |
| Standard deviation of domain lengths | 50.38 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0YC33 | 271-548 | NMSEFATYLKVGITSIILKMLEDGFFEGDIILKEPVKGIKLVSLDLTCKKPVMETLGGRKLSSLDMNWEFFERAKQYFSQVCEPSPE… |
| A0A838KM98 | 25-265 | LAEISTLLKVGTTALVLAMIEERVISADLAIDGPVSALHAVSHDPTLTHLITLKDGRSMTALDLQEIYLELARHHTAERYGDDADPD… |
| A0A3D0TW66 | 4-254 | None |
| A0A0S7ZQI5 | 179-438 | None |
| A0A2Z5QS05 | 4-203 | None |
| A0A2Z5QU87 | 700-1015 | None |
| M5RUF1 | 218-441 | None |
| A0A6L5C6N6 | 483-719 | None |
| A0A1F5BWQ1 | 145-407 | None |
| A0A0K8QEJ5 | 450-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.