DPCstruct | MC43173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 350 ± 65 aa |
| Standard deviation of domain lengths | 65.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0020- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2MRE9 | 5-302 | IAPSTQTKVYRDPTLEFRDIMWPIIVMNLEKFIHTEFKNVHLCIIVAHVLTGSLKYSELEENGGIRHLLIELVTYFMEISESSDCLT… |
| A0A2R7W8W5 | 237-614 | LNCVLSVASHNIVPTQVALVESLPGAYQQVSRVLALQDVAGLLAESLDCLNNRHLPAPLIKAKLVALDNLVQSPLFKAQESRPVLLS… |
| A0A7R8H2G2 | 2-315 | None |
| A0A5E4PVU9 | 444-834 | None |
| A0A821RRP8 | 684-1061 | None |
| S9WYG2 | 10-353 | None |
| A0A815KG31 | 58-539 | None |
| Q55BQ8 | 1260-1671 | None |
| G3IDC5 | 27-367 | None |
| G3N403 | 345-681 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.