DPCstruct | MC43170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 150 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2MCS0 | 1-145 | MFQTLMNSYKSRVPNFLLPDVTGFREEFKGLDEFMFSETFLDFIIECFVKWYNNSYFWKKDSPDLFLFILLCMCLILRVSQDRQISE… |
| A0A0C2J5H4 | 245-397 | DTLNMFFFIYYFPEGFNIQEKLSDLYKTSTCRFLLPEIGQLRESFIGMNSFLFSDDFSGLIMHVLVNWNTNRGRTEKVALDNLLLVT… |
| A0A0C2JYY4 | 506-654 | None |
| A0A0C2MM33 | 268-419 | None |
| A0A0C2M4M6 | 285-433 | None |
| A0A0C2JA93 | 1-161 | None |
| A0A0C2J0A8 | 39-189 | None |
| A0A0C2IMJ0 | 324-471 | None |
| A0A0C2IIT5 | 1-144 | None |
| A0A0C2IF59 | 11-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.