DPCstruct | MC43169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 181 ± 21 aa |
| Standard deviation of domain lengths | 21.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.30 |
| Pfam Score | 75.73 |
| Assigned Pfam label(s) | CL0020- PF18004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2M8F1 | 5-197 | KSAFVAAGMVLVQRNEKTTESFRDIRSQLTSLCHDRRAEAVAKLGAYVGLGIMDAGCRNQTLAFKTLQGHTRMPSIVGFLVFQQFWY… |
| A0A287GHB0 | 185-343 | GISCAGTGLSDAISLLEPLTSDVVDFVRQGALIAMAMVMIQTNESFDSRVGTFRRQLEKIILDKHEDTMSKMGAILACGILDAGGRN… |
| A0A444U653 | 808-983 | None |
| A0A813GU74 | 60-252 | None |
| A0A812S8Z6 | 157-346 | None |
| A0A0R3Q5T7 | 55-223 | None |
| A0A830CGF2 | 475-654 | None |
| J9DRM3 | 130-335 | None |
| R4XB38 | 662-848 | None |
| A0A6G3MEK2 | 82-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.