DPCstruct | MC4316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 63.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D1GMU8 | 68-165 | DRNPDYEHTLDTLDVEIAMATLPMDFNIYELPGSVYRRAKEIVKKKESPFKEWSAALRATPGILDYSRAAIFALIRSAHPEFYHYPG… |
| A0A485BMM0 | 192-297 | NAGGGNKTDRNPTLTHTLDTLDIEIALATLPMDFNIHDIPGGVFRRAKEIVSKKESPFKEWSEALRKTAGILDYSRAAIFALIRGAA… |
| A0A403NK79 | 42-151 | None |
| A0A2T3CKF2 | 12-132 | None |
| A0A826R5P2 | 1-119 | None |
| A0A090V4Q6 | 533-635 | None |
| A0A726QB57 | 265-374 | None |
| A0A485A880 | 3-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.