DPCstruct | MC43156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1504 |
|---|---|
| Mean domain length (aa) | 115 ± 23 aa |
| Standard deviation of domain lengths | 22.97 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.98 |
| Pfam Score | 94.18 |
| Assigned Pfam label(s) | PF01288- PF09309- PF06732- CL0123- PF12258 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0ML11 | 23-134 | NEGGPNSVGDGHVPSKILKDLVFAITGNFGKDRDSVFTMIKELGAGDISPTVHKRVDFLLADDDAVSSETKHIRKAVKYGVQVVSLK… |
| H3C8W0 | 70-174 | PPGAKPCSQHIMSVTGFVDADRDDLKLMAYLTGARYTGYLCRSNTVLICKEPVGLKYEKAKEWKIPCVNAQWLCDVLLGNFEALRQI… |
| A0A482VEE4 | 374-480 | None |
| W6Y0J9 | 2-106 | None |
| A0A2W1BSD6 | 321-416 | None |
| A0A2W1BR07 | 1-162 | None |
| A0A6V7PCS8 | 359-461 | None |
| A0A2W1BL50 | 7-127 | None |
| B5VL86 | 2-107 | None |
| A0A812PCG5 | 59-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.