DPCstruct | MC43155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 105 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6DMH6 | 53-158 | KDGKRVTDCLKKGVKIANQCMDSSVQVQLFVELLNHYIYYYEKGCDQVTVQVLNQLITKIKETLPSLEANEETEQINKHFQNTCDHL… |
| A0A7S0MJC1 | 1-111 | GEEGRVVKDGKRVLDCLQRSLKIADVCMQSSASHANLFVEILDRYLLYFEAGNDKVTIKYLQGLVDLIEEHLANLDPGPDSASVRAH… |
| A0A7J8CMZ3 | 231-343 | None |
| A0A085LSC5 | 56-150 | None |
| A0A7S3GBF2 | 119-221 | None |
| A0A2H8TQP9 | 1-103 | None |
| A0A183CUQ8 | 70-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.