DPCstruct | MC43154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 276 ± 78 aa |
| Standard deviation of domain lengths | 78.49 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 65.44 |
| Assigned Pfam label(s) | PF06883- PF04561- CL0410- PF04563- PF04567 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0MES3 | 37-272 | NSVTIGIEKLISSGNIYSDFKGELSQLSGLSISIERLNFGRFISYFRSVHRGKFLSEIKGTSGRKLFPQSWGFMCPVHTPDGALCGI… |
| A0A0A9WS74 | 1-214 | MNRQGITQVLSRLSYIATLGMMTRIASSFEKTRKISGPRSLQPSQFGMVCPCDTPEGESCGLVKNFANLSQVTLDLDDTLVRHAAHN… |
| A0A6S8SMV0 | 108-432 | None |
| A0A0B1PSN9 | 23-278 | None |
| A0A1P8BFS9 | 346-726 | None |
| A0A1I8FE81 | 95-334 | None |
| A0A1A8YX78 | 44-271 | None |
| A0A7J0EQ13 | 176-494 | None |
| A0A835HHZ0 | 557-737 | None |
| A0A6A2XBF3 | 547-833 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.