DPCstruct | MC43152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 180 ± 29 aa |
| Standard deviation of domain lengths | 28.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 67.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.20 |
| Pfam Score | 88.62 |
| Assigned Pfam label(s) | CL0063- CL0221- PF01480- PF06775 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0LZE7 | 40-212 | QQAAALAGKKGLVHTVVPALPVALFNADEEEEERERAAQQRKRMRLERIDYGEHALEADKKAVAATAKSIIDRIPTDTDALFAFPVQ… |
| A0A7S4F7G4 | 1-122 | AVAALERAPAAAGPSAEQLKQMILSIPTKRADLFVAEVDWDVALASNVLDEKIKPWISKKMVEYLGEDEPTLVEFIMGKLHAKTGAE… |
| A0A7S0PV17 | 249-466 | None |
| E4ZHI1 | 81-275 | None |
| A0A1I8IBD8 | 1030-1211 | None |
| A0A7I4CWD0 | 477-579 | None |
| Q4N2N0 | 176-355 | None |
| A0A0M8MP52 | 330-473 | None |
| A0A3R6ZBJ2 | 181-294 | None |
| A0A0V0W3V4 | 550-701 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.