DPCstruct | MC43150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 352 ± 35 aa |
| Standard deviation of domain lengths | 35.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T7Z9X7 | 1-333 | PYIPLLVSMGFLLLVLGLVLSLITILRDNSWSGIHFRFSALKVRSGLTASQPGINSFGLMRSGCSSIFDGQQSNLTISNSTIILSFP… |
| L1IVD1 | 2-302 | ILAMLSSMYFSICLRWIQILKVNGIRSFRYYRFSVEGIRSRGNSTYAHAQTFGILKDGVDVRNSLWQKSVRHNMTWQPDGSILLSFE… |
| A0A7S0M9D8 | 468-860 | None |
| L1K3K4 | 541-935 | None |
| L1IYS9 | 622-944 | None |
| L1JHM9 | 89-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.