DPCstruct | MC4315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 210 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0436 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847CGY4 | 102-314 | VAEKEKDGKESIYRRVAKFLVLIGEDEAAKILPHLSEVQIEKIIPEIASIRTVSKDESSVILAEFKSLLDDSRKSGGIETARDILQK… |
| A0A376LJR0 | 2-217 | SELTTNKSNSYLEQAAILLLCLGEEAAATVMQKLSREEVVRLSENMARLSGVKTSMARKVINNFFDEFREQSGINGASRSMLQGILN… |
| A0A7R9JCN1 | 2-177 | None |
| A0A812ZF38 | 7-226 | None |
| A1UTV8 | 35-245 | None |
| A0A2H5XQR2 | 55-275 | None |
| A0A258TS93 | 547-760 | None |
| A0A1B0C4W0 | 745-953 | None |
| A0A1A9X6M4 | 422-645 | None |
| A0A484X5N9 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.