DPCstruct | MC43141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 385 ± 74 aa |
| Standard deviation of domain lengths | 74.17 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.73 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | CL0029- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194V5M1 | 15-407 | PRFQAYTKLLRVRSGGQVEEPNNFDEFSVSGYDIHDLDDDDTLHPATLCGSGETKVKRAFLDRLSELVANKKGGHYTSASMMIEWPD… |
| A0A1B7NUX0 | 109-561 | RLPKPFEEPATASDIQNLIAAIGKLEKRDRAQLPSNRYSLDTEEIVPLSSPTRVPRRLAKLLDSLAGLLVSNANHEVIATALRVDAT… |
| A0A6A4GCM1 | 361-686 | None |
| A0A2P4Z748 | 3-337 | None |
| A0A166CCC2 | 14-500 | None |
| A0A4Y8CNC9 | 235-722 | None |
| A0A2H4SIU9 | 197-708 | None |
| A0A3N4KET7 | 35-484 | None |
| A0A4S2N679 | 10-335 | None |
| A0A3N4J929 | 3-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.