DPCstruct | MC4314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 253 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0039- PF11922 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485CJQ8 | 30-290 | ITFELFVQKFADWFSGQRPAAVMVGIRADESYNRFLTIASQRKRRFADDKPWTTVAPGNHAWYVYPIYDWKTADIWTWFAKSKQPYN… |
| A0A376LJQ2 | 1-238 | MIGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANHQQLCNPLYNIMYQAGVPLRHMRICEPF… |
| A0A0A8RMJ6 | 24-277 | None |
| A0A268TAM0 | 1-286 | None |
| A0A2D6XAC8 | 323-580 | None |
| G6FBJ4 | 40-333 | None |
| T1I864 | 1-225 | None |
| A0A485HQ16 | 24-277 | None |
| D4K2P3 | 21-246 | None |
| A0A2X4YVM3 | 1-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.