DPCstruct | MC43139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 928 |
|---|---|
| Mean domain length (aa) | 245 ± 57 aa |
| Standard deviation of domain lengths | 56.87 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.99 |
| Pfam Score | 68.52 |
| Assigned Pfam label(s) | PF01267- PF12449- CL0108- PF08676- CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K1MKT9 | 1-238 | MKKHTAKITSKSIEQSGLPSDFKKAIAEYIWNGFDANASVVELDFDANAVGYINSFSISDNGFGINLGRIDETFGQFMDSHKTKTFD… |
| A0A356KLY4 | 5-163 | TYPECLAAVLENAFDQVREGPCRSIQLEILGESFRVRDDGEGLPVHPHPFSKRPLLEVILMGPRRGEPNTLARVTKCCLWVEVETET… |
| A0A2E8RAW9 | 8-222 | None |
| A0A835XU63 | 17-225 | None |
| A0A5D3D2J3 | 268-563 | None |
| A0A6A5ZXK6 | 10-230 | None |
| A0A7Y4TSG6 | 72-346 | None |
| A0A4S4DEP1 | 154-395 | None |
| A0A821RZU8 | 1-203 | None |
| A0A1H6J790 | 8-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.