DPCstruct | MC43136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0T6J2 | 4-92 | LVGLLPIIGIALLFWLLIIRPQSRRQKAVVAMQSTLEPGSEVMLSSGIFGTLEQVADDHVRLRVADGVTLKVIKGAVANVVPPEDEH… |
| K2PUY0 | 2-53 | IAELHQKLAVGNEIMFSGGLTGTITQLDEEFCRVKLADKLDIKVSRYAITQI |
| A0A212DRB8 | 17-116 | None |
| A0A2T7TNB6 | 4-72 | None |
| A0A812ZKH6 | 554-643 | None |
| A0A1Q8JKD3 | 117-207 | None |
| H3NN91 | 18-107 | None |
| A0A3T0Y4X9 | 7-107 | None |
| A0A2V2EUA4 | 18-119 | None |
| V7HVE0 | 4-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.