DPCstruct | MC43128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 148 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 35.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0Q764 | 1-182 | GGGGGGDGGVGGGGGGAIQLVANGRVRFAGTQLVFYPGVNAGGCFGKRGTSDDAGGGGGAGGAILIEAPTVELNAAGLAVNGGGGGA… |
| A0A7J5EWE3 | 242-398 | GAGGGAIQITAMGSIVIDGTVTAGGGGASGGGNTAGGGGGGSGGMVLLEAGTEVRGGGYLTANGGGGGGGGGAGGNATAGAAGCAQC… |
| A0A7Y4KV51 | 1-158 | None |
| A0A356TGW4 | 13-147 | None |
| A0A7W0VWF3 | 2-133 | None |
| A0A7C4PXD5 | 337-490 | None |
| A0A7W0VSM3 | 2-118 | None |
| A0A7W0VND2 | 59-209 | None |
| A0A2W5TMG5 | 512-657 | None |
| A0A2W5SRP7 | 641-778 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.