DPCstruct | MC43123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537FJT8 | 109-246 | MGVSVLLDSDVEGISVKKQLIESPIARETNVLFVNDATQESGRVMELEDLLPPSLYLKFVNDAYSGELGKNRLGNEALAKDVQIRRY… |
| A0A433S9E3 | 1-134 | MGNHLDVTVVVDSRKEGHQKLTALAKAGFLGEKRIITIGEVADRKMADIEDLFAKDDYVALYNAAFGKKIKAVDLKGTDPIVRQIAR… |
| A0A2H6FWF8 | 9-151 | None |
| A0A496WV05 | 303-446 | None |
| A0A4Q3N6A6 | 47-180 | None |
| A0A2V6I7J8 | 142-272 | None |
| A0A829RQW6 | 135-273 | None |
| H5TRN9 | 12-140 | None |
| A0A7I0PSQ4 | 100-233 | None |
| A0A7C2TI32 | 12-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.