DPCstruct | MC4312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376LE72 | 1-74 | MQSYNSHDDEVGGNMSLTYDGTYGTVNGSYNYSQNSQRLNYGIRGGILAHSEGVTLSQELGETIALVKAPGLPG |
| A0A7H4PEF9 | 43-95 | SNSGNANMSYQGTYGNLQAGYNYSDGYHQVNYGVSGGVVVHRNGVTLSQPLGD |
| A0A376P5J3 | 61-120 | None |
| A0A6N8PL23 | 44-104 | None |
| A0A377K065 | 98-157 | None |
| A0A377DAD1 | 365-433 | None |
| T1H9L3 | 92-150 | None |
| A0A4U9UHR6 | 155-209 | None |
| A0A833KRH7 | 62-127 | None |
| A0A447MAK5 | 39-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.