DPCstruct | MC43119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7J630 | 1-91 | MDNPASQLGRTYLALSESRSWLMLHELAAEIRKRFDRLDSEAAISARLRDLRRQHGLIVESRRRGDSAAHEYRLIRLAPVKRQPDML… |
| A0A0F4NNX7 | 13-91 | NTNTQFGRVCYVTAGTEWLTLRDIEKRIGRLFKDKDTQAAISARLREVSPIKHGFVKERRHEQINGKRVYFYRLVPFVQ |
| A9KZP6 | 1-73 | None |
| A0A2A4GGI4 | 30-125 | None |
| A0A7X4XAD6 | 13-103 | None |
| A0A239Y0R3 | 7-100 | None |
| A0A6M3Y2H6 | 1-93 | None |
| A0A2T3NIB1 | 22-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.