DPCstruct | MC43118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 254 ± 23 aa |
| Standard deviation of domain lengths | 22.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G6A7L6 | 1-271 | MSFRHACPGIAGALFLLTAMAAPADPFRDHDGQLPPPSQYSGPSFRLSHAYPSGLPAPRMPWRTAIGNVPISTGNAAAYTQALKDSI… |
| A0A451BDQ1 | 1-238 | MRSFIVSVSILMCPMLVHALQHHYPDYSDPVPDDYTGKKFRLSQNYPSSIPVSDRPWESIDFTKNPNRYLRTIRDYIYQGMREIDWE… |
| A0A366PU75 | 7-272 | None |
| A0A7W9K088 | 1-226 | None |
| A0A073KQG7 | 1-275 | None |
| A0A838EVN4 | 176-415 | None |
| A0A366RLG6 | 7-272 | None |
| A0A1E8PL03 | 1-274 | None |
| A0A7H0GBH1 | 318-524 | None |
| A0A2P8FBL5 | 17-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.