DPCstruct | MC43110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 24.82 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.66 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | PF18406- PF06924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1XZB8 | 18-130 | FAAVLPLPKGFEETREGEDYREVIDWQSANWGTKWDLEDTELTVVAEGTKATAKFETAWSPPQEWFAFVVRKYPRLRFELAYQEGGM… |
| A0A373XYT1 | 3-160 | NHITTRIKITGDPEAVKRVLNKIKNDEFGMGTIDFEKIIPMPKNIFKGNLGVRERELYGNNNWYDWSVANWGTKWNAYGFDPNTDYS… |
| A0A7B8FZY0 | 47-179 | None |
| A0A3G4RTQ2 | 18-136 | None |
| A0A517NTB5 | 1-158 | None |
| I7J1I8 | 1-141 | None |
| A0A843FJE9 | 71-176 | None |
| A0A5C1ISX8 | 1-144 | None |
| A0A2V2BFR6 | 2-116 | None |
| A0A3P5HE31 | 11-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.