DPCstruct | MC4311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455U5R3 | 30-83 | EIVQERLEREYDIDLLTTAPTVVYELAMKNGDVQYVSNPSKLPDMADVDEMREP |
| A0A376L9K2 | 1-74 | MEIIQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELREPIAECHMLLRRHISATLLRC |
| A0A2P2MGL6 | 119-180 | None |
| A0A6P9B4A5 | 1-82 | None |
| A0A7R9DIY2 | 224-290 | None |
| A0A1V3XIN4 | 156-227 | None |
| A0A377LV08 | 1-75 | None |
| A0A447P4Q0 | 1-68 | None |
| A0A7J6YQZ2 | 349-402 | None |
| A0A448QS45 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.