DPCstruct | MC43109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 332 ± 40 aa |
| Standard deviation of domain lengths | 39.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0R3C4 | 756-1075 | PEILLTERTRLQLVVDEIMSQPEERLEEIAMSYKDLLLSDNLVALMKERLNAMAYRDMEARRQGDEDRFKEQHGRERAILINLAKIG… |
| A0A7S1XYX0 | 1-390 | AGPDAPSPAVASAAATRLAKIPVSDLVKSWPAAQREVFVQELKSLKGVMGGLAEVAEADDDALQPGDAPTSEMEQQALVQTLDANRA… |
| A0A7S1GP29 | 1-322 | None |
| A0A7S0GG33 | 1-393 | None |
| F0V7E6 | 849-1175 | None |
| B7G242 | 3-268 | None |
| J4C3Y9 | 315-593 | None |
| A0A7S4BVN1 | 68-409 | None |
| A0A4D9D958 | 432-798 | None |
| A0A7S2V7M2 | 156-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.