DPCstruct | MC43106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 152 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519LGA1 | 13-148 | ETTIKEIYIRKEPELRAEEMEKFFHGAYESIDSIIAFHVSVGFLHHESKKRINGLDYDKKYFVTQKCAERISEHLLKMPSVNWYFER… |
| A0A1C6QTB7 | 156-319 | RCPDFLAHELLTEVEQDRQPAGPTLRLVADMIGGVAPSLHRYPMTKYLYGAYERPDNALALLASRKHIAVRRVNESSSNARRDYYLL… |
| A0A4Y8M887 | 38-198 | None |
| A0A844BBT3 | 22-161 | None |
| A0A2U3BZZ8 | 5-133 | None |
| A0A0C6F9S6 | 165-331 | None |
| A0A6P1NMN9 | 66-224 | None |
| B1T1V0 | 1-117 | None |
| A0A2U9PI83 | 9-176 | None |
| X6FLW2 | 3-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.