DPCstruct | MC43105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 213 ± 17 aa |
| Standard deviation of domain lengths | 17.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5X2F8 | 13-212 | FIKRNRHLTDESLPWAGIAFDPPVGSDELFHQLKSAYPSCDNLRQRKHLATIQFLIVELDAMRKKDSEQSKISKSAEDQETRYSNNP… |
| A0A178E6Y3 | 77-277 | MRPIKRTRPTSDGTEPWKDLSFTEPVDSDALHDLLRTQYPGYANLRERKHIAAIEFLQAELSLMQSKEPAHGDLVALPSPDAPSFSS… |
| A0A6A6AD79 | 12-250 | None |
| A0A2V1DZ04 | 1-232 | None |
| A0A177DKJ3 | 1-195 | None |
| A0A4Z1P8R2 | 12-241 | None |
| F9WXW3 | 390-607 | None |
| M2SK19 | 3-186 | None |
| A0A7C8I2N3 | 36-245 | None |
| A0A139GX12 | 16-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.