DPCstruct | MC4310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 153 ± 31 aa |
| Standard deviation of domain lengths | 31.36 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.43 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF02322- PF01654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5TNY3 | 84-228 | LLSLLIHFDPNSTITGLDQFPREEWPPISAAFYPYHLMTGLGFFFIALTWWGLLMGQKREKNQLFLKVMVYSSWLPLLTMNLGWVAA… |
| A0A376L8M3 | 48-192 | AQYQAAMRGAIPQVAPVFWSFRIMVGCGSLLLLVMLIALVQTLRCKIDQHRWVLKMALWSLPLPWIAIEAGWFMTEFGRQPWAIQDI… |
| A0A0K2RDW4 | 2-163 | None |
| A0A4U9CVG6 | 3-120 | None |
| A0A378LQ48 | 246-451 | None |
| A0A7C6FEM9 | 2-126 | None |
| A0A4Y8LZ29 | 246-474 | None |
| A0A6N6XDE3 | 9-144 | None |
| A0A376E4L0 | 83-234 | None |
| A0A4Q8XRI3 | 73-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.