DPCstruct | MC43093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 160 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1F279 | 10-177 | LNTTRERILEAPWGERNAVLEEEARFLGMSPGGLRAKLRRELCSDELFDTTRQRRSDAGSSTISQDDLMTVARYLVGGARKNGMMGG… |
| A0A484XH85 | 10-181 | PAEALLQLRQRLERLSPKNPERALQIAAMSQLYGVSATSVYRALNDLLKPHTVHRIDHGQPRILPRQEMERYCELVAALKFRTTNKK… |
| A9LYV2 | 1-169 | None |
| A0A1A9WW68 | 257-399 | None |
| A0A0R3QDF7 | 297-449 | None |
| A0A1A9S019 | 1-154 | None |
| A0A272EQV7 | 1-155 | None |
| A0A378VY05 | 72-230 | None |
| A0A3S4VXR8 | 2-180 | None |
| A0A2Z6CLT1 | 6-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.