DPCstruct | MC43090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 178 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A679IW85 | 1-150 | MGKRPVIVDVATLADLLGVHIRQIPKFADAGTVVRVAHGEYDRDASIRLHVEHLRKVAGGRSQSSTLAAERERLTKAQADAAELKLA… |
| A0A3B9ZIR9 | 8-212 | QNLAEIARKKRHLYLIEKMQSRKPLTAQEIAELEQFEAEPLGPAVVKTMEEVAKVMDVAYRTVQRWKKDGMPTTKEGFYDLDEIKVW… |
| A0A518LAV0 | 1-149 | None |
| A0A091AL28 | 14-212 | None |
| A0A1V5D5A6 | 12-195 | None |
| A0A2A2ILE0 | 1-151 | None |
| A0A496YPQ2 | 183-363 | None |
| A0A7C5TW46 | 14-221 | None |
| A0A349HKL2 | 72-252 | None |
| A0A1H8BJ64 | 95-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.