DPCstruct | MC43084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 278 ± 83 aa |
| Standard deviation of domain lengths | 82.89 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 88.44 |
| Assigned Pfam label(s) | CL0425- CL0163- PF06350- CL0105- PF00374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A410PAD9 | 83-390 | QMDQNSWEIFKYLKGPAISEKLCWSRVVKLLIFYGLALLWQILVHRPLSSIFSEKENKYMIYSKLPPVRERCIIIFVSEEKRLIYLM… |
| A0A832I2C0 | 384-710 | GESVLALDVRLGWAYRGLETLARGAPLGRALEIAERACGACAFSHALAFSQAVEEVAGLLAPPRARALRVLAAELERLAGHLADVAG… |
| A0A1R3L2H5 | 2-171 | None |
| A0A1G7EDZ0 | 80-232 | None |
| A0A662U2D5 | 202-534 | None |
| E0CVJ6 | 19-215 | None |
| A0A7X7XEH9 | 30-255 | None |
| A0A843M3M2 | 10-232 | None |
| A0A3B4AD68 | 122-442 | None |
| A0A2G2X0N0 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.