DPCstruct | MC43080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 159 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418VTM4 | 33-179 | SDLEALLADPSPAHQARTAAKVAMAWRSGTLDGAARSAAEELFRAIAAKAVVAVRAALAEALKDEPSLPHEVALRLAHDVDAVALPM… |
| A0A352CDS3 | 26-165 | REMMLRRLCEVVSMPLTRISRHERDMAGDILIELLKLGSAAMRQQTAQRLAALADSPKRVTLLLARDDVSVARPLLEESTALNDSDL… |
| A0A2E6KK16 | 2-185 | None |
| A0A0P7YBW5 | 8-174 | None |
| A0A2T5V1M9 | 2-164 | None |
| A0A2T4ZG39 | 3-162 | None |
| J6UB19 | 98-258 | None |
| A0A4Q9VHK3 | 28-188 | None |
| A0A2N3C0V8 | 347-500 | None |
| A0A4R7BQW2 | 5-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.