DPCstruct | MC4308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 24.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039- PF11922 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376LJQ2 | 53-240 | IWTWYANHQQLCNPLYNIMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSGGIYAGHDNHFYGHRKILKPE… |
| A0A376KYL3 | 2-160 | YQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSGGIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKT… |
| A0A268TAM0 | 74-288 | None |
| A0A2A4H8Z7 | 1-199 | None |
| G6FBJ4 | 116-332 | None |
| A0A2D6XAC8 | 397-576 | None |
| A0A0A8RMJ6 | 125-281 | None |
| A0A139KR08 | 9-221 | None |
| A0A485CJQ8 | 104-297 | None |
| A0A485HQ16 | 125-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.