DPCstruct | MC43070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 173 ± 29 aa |
| Standard deviation of domain lengths | 28.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0JPH4 | 20-220 | IIISDIFVFLDHVSYSKNDWVNRNKLKNSNGSFTLTIPVEKNNGSSIKETRISGNDWRNKHLKSFYYNYNSAKYFAEIFPFLEGLYQ… |
| A0A0U3B1X0 | 20-220 | VKAVDTFVFFDDVAFIKRGFINRNNILVNGQAHRFSLPVEKASQNRNINEHYYLAHQHNFLKTLNHAYKCAPAYTETRAIVENVVNH… |
| A0A4V1K555 | 6-174 | None |
| A0A388Q3C9 | 4-137 | None |
| A0A1V2YLE0 | 9-203 | None |
| A0A661WWN9 | 25-189 | None |
| A0A0G1DRS3 | 2-164 | None |
| A0A4U1LZJ3 | 39-174 | None |
| A0A7I8CCL7 | 1-160 | None |
| A0A828NXQ9 | 9-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.