DPCstruct | MC43067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6PSC4 | 39-133 | FPRWTARSRDGIDLGLWRGLDPSRLMVPLDTHIAFLGRAPGLTKRRTAGWMMAEEIPAALRTLDVRDPVKYDWSLTRLGDLGDCPSR… |
| A0A5M9QU57 | 165-251 | KRWNMFLRWLTRKDHIDLGLWQDLLSPSDLLLPLDTHTLRISRALTLLQRKSYDRKAVLEVSAALKRFCAHDPIRYDFALYRIGQSG |
| A0A1H5VF79 | 2-85 | None |
| A0A7W1VYY4 | 152-241 | None |
| A0A1Y1RB43 | 49-140 | None |
| A0A1Q7GHF8 | 101-207 | None |
| A0A5B5UJG9 | 244-343 | None |
| A0A0D6QQ08 | 3-76 | None |
| W5SS08 | 28-111 | None |
| A0A3C1BX61 | 121-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.