DPCstruct | MC43066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 426 |
|---|---|
| Mean domain length (aa) | 168 ± 30 aa |
| Standard deviation of domain lengths | 29.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0A1M0 | 19-162 | IAVIPFDEQAVEESPTLKGQPVAFKDIVDVAFVPTTCGTNVDVGRIPIEDAPVVQRLTAKGALPVAKANLQEFSYGILGDASAYGRV… |
| K9IEG3 | 31-215 | DQIEADQAVLNDFVTINRDEALKQAQAIDEKGVDPDNLWAGIPIAVKDNIVTKGLKTTASSKMLSNFTPIYDATVIERLKANDVIVI… |
| A0A0K0E0M2 | 1179-1369 | None |
| A0A814VKG4 | 191-435 | None |
| A0A5C6SZ96 | 105-288 | None |
| A0A0N0P4Y2 | 15-274 | None |
| G5HJH7 | 440-615 | None |
| A0A542MX95 | 408-560 | None |
| A0A5C4M1I6 | 108-276 | None |
| A0A0V0R127 | 157-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.