DPCstruct | MC4306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 169 ± 18 aa |
| Standard deviation of domain lengths | 18.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853B9F9 | 28-197 | NANTRNGRLLAGLVLVGIAAYVYPSPADLDEQRVRRVAETEFEQWLRAACERLRDRDAAGEPIPEEGLDEAWRAYHEKPAILVGDRG… |
| A0A7X6P3L9 | 1-155 | MRPTTDTHRSIVGLVLLAVARTAYPEPAMMDDPDHIAVFTTNGVVDTLDRAVSLCLEDADPDGDADEDLYEAFRRWNDKRRTDLKSG… |
| A0A1Q8LYL5 | 88-253 | None |
| A0A3A1VRV4 | 1-137 | None |
| D6K6K5 | 23-193 | None |
| A0A7K2Z7Q6 | 101-307 | None |
| A0A1Q8KWM1 | 70-252 | None |
| A0A0H1RA15 | 96-242 | None |
| A0A7K2QC33 | 17-198 | None |
| A0A1Q9NAQ9 | 101-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.