DPCstruct | MC43055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 83 ± 3 aa |
| Standard deviation of domain lengths | 3.30 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9Q6V0 | 1-85 | MSKDCFDRFGDDLSEVLLSYLSFEDRFRCESVSKQIQRVIFKTQTKLNIRKSKKFISVGEKCNDFTVFETILQKLPNITDVDISY |
| A0A7R9QPE1 | 1-78 | MYGKDNIDRFGDDLCGLLLSYFSFEDRFRCECLSKRWQRLALESQKDLTTDFSYITIFRKNPTIFESILKKCANIETI |
| A0A7R9PWM6 | 118-203 | None |
| A0A7R9Q5I4 | 4-81 | None |
| A0A7R9QI77 | 1-85 | None |
| A0A7R9QQX8 | 5-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.