DPCstruct | MC43053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PXC6 | 1-119 | MTWAQLDVHSNATLNDSLQAYSSGLIEGHLTADLIDFHWNNNIQHYCDNSSQFCDILFPFIEKNVEFMKTEIKKYAKTDEYWHQIEL… |
| A0A3P7KZ19 | 60-177 | VNASGWTFLEVETYSKFNPELQAYAAGYLEGVLSRQVLRYHIQNAVEDYCKNFTQYCERMTSFLTENQKYIKEKINATPRDDVYWSA… |
| A0A7R9MK90 | 17-131 | None |
| A0A6G0Y135 | 79-178 | None |
| A0A0M3IVM4 | 9-119 | None |
| A0A5S6QFS7 | 23-133 | None |
| A0A7J8H5J9 | 93-212 | None |
| A0A6V7VTD7 | 113-225 | None |
| A0A6M2D8Z4 | 57-172 | None |
| A0A7R9KC56 | 396-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.