DPCstruct | MC43052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 13.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9M0F0 | 2-107 | LFPFDIRQTYFLSTAFGTSRSIVWLQNQRDTTLERVRGPSPRRDDPHDFRVGRLKHERVKVPRGDRLLDWGLQVMNVHSNRKAILEV… |
| A0A3P6N1U5 | 239-362 | IFTFTSRRNLLYCTAFGRDRALMHLVNQTDGGHADGESGRLTPRLERRKVSIKRDDLLRQAEQTMNHLGGSRAMLEVGFEGEAGTGF… |
| A0A1I8JMN7 | 121-234 | None |
| A0A2G9RP41 | 3-103 | None |
| A0A2H2IIB4 | 49-207 | None |
| A0A3P6T7F5 | 15-129 | None |
| A0A0R3R830 | 252-375 | None |
| Q8JFV5 | 2048-2171 | None |
| A0A183IVM9 | 435-572 | None |
| A0A453AFT2 | 242-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.