DPCstruct | MC4305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367B1F9 | 104-233 | ARQNFNAVVASSQWRTYVALTATVMSLSDNEARTRVRDALQAAERVFIERMSNFYADMSIMFGFRLKSYINSYETLAAVGASVVEGL… |
| A0A7X6P0R4 | 1-133 | MGAKQNYDDISSSAAWRTFMALSVSLDGLPPERRERVTETMQIVEARFIDTMSEFYEGLLSVFGRRVRDGLTLRHIATAGTAVVEGV… |
| N1MD39 | 104-247 | None |
| A0A838PVS1 | 26-161 | None |
| A0A850J9W0 | 103-243 | None |
| A0A545AMR5 | 76-227 | None |
| A0A7W1UTT0 | 3-138 | None |
| A0A0M8MM27 | 17-155 | None |
| A0A1B1BLW6 | 43-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.