DPCstruct | MC43047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 345 ± 59 aa |
| Standard deviation of domain lengths | 59.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 78.42 |
| Assigned Pfam label(s) | PF20719- PF20718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9LGR9 | 62-381 | IKASLYRCLNTSSANNSGQCKAGDFYTLIMLNAIATTLKSLLRPRDNQENEGPAENLSLLIQNKGNDMQYMKVDTILINLDNKDFCV… |
| C7YGY8 | 313-767 | MADDGKIRWNKLHFPLGDIGNGMQDPHYSGSIAALTVTAAPSMFYQNNYDDMLAIVRPYTTKKRFVQDWVTELIRILKIQVDYSEDT… |
| A0A1A9XPP8 | 379-733 | None |
| A0A7R9ARH0 | 149-457 | None |
| A0A6G1LRE3 | 80-472 | None |
| A0A284QVT0 | 176-595 | None |
| A0A6A4JVV5 | 493-783 | None |
| A0A080WJY7 | 270-653 | None |
| T1PJM9 | 3-249 | None |
| A0A4U0X9S5 | 74-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.