DPCstruct | MC43043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 237 ± 50 aa |
| Standard deviation of domain lengths | 49.58 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 94.81 |
| Assigned Pfam label(s) | CL0176- CL0713- CL0036- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9LBX7 | 27-274 | TIRYYQLIWMTMSGSHRLWSHRAYKAKLPLRIILMIIQTLGFQSNIYKWARDHRLHHKHSDTDADPHNSRRGFFFSHVGWLLYMKHP… |
| A0A812TF05 | 14-214 | TGLGITAGAHRLWSHRSYKATLPLRIFLMLLNSMANQGSIYHWSRDHRVHHKHSETDADPHNATRGFFYSHMGWLFVKKHPATIMAG… |
| A0A3Q4HMJ1 | 25-219 | None |
| A0A834N4K7 | 2-170 | None |
| A0A1Y2HMH5 | 32-299 | None |
| A0A7R8X8E6 | 383-627 | None |
| A0A7R8XJ71 | 265-517 | None |
| A0A482VK63 | 29-324 | None |
| C5E0Z2 | 84-395 | None |
| A0A172SNJ9 | 16-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.