DPCstruct | MC4304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 180 ± 24 aa |
| Standard deviation of domain lengths | 23.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6DZU1 | 12-195 | VQRAGAAGSELRRRYPLPDHLVRATALGNALAAAEDSAGRAYGLDAVAAWPRLYPALGEQARLVVDDLRDRMDASARMAVTMAATTL… |
| A0A7X6ARZ7 | 43-227 | SQESTARHSEITVSFPSDNLAQTTMGNVARSVASYARQRYGMDLDFMWTRLQKVMEGDDHYRTLMEAQIRVDFVVSMFWLLAFSLVL… |
| A0A7W3THM9 | 2-149 | None |
| A0A1H4R337 | 86-250 | None |
| A0A5P1ZG63 | 4-176 | None |
| A0A1M5LYR1 | 224-411 | None |
| A0A7W0TZR6 | 423-620 | None |
| A0A399ZUL6 | 20-206 | None |
| A0A3E0P141 | 334-503 | None |
| A0A197SNR3 | 7-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.