DPCstruct | MC43038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 122 ± 22 aa |
| Standard deviation of domain lengths | 22.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.10 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | PF04800- PF05030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8EY85 | 8-129 | NRFSTSPHHHHTSSSFEKNTLREGEHFKKVIGFKPSKIASSQGASYISNPWRLRDATASGEVNHWENPLQGYVSFGSEGKVPKTLEF… |
| G2XJ19 | 68-190 | RIQDGSEDVPYIQAATVSGAPMELQGRTVRIYQETKPATQSGNWQGHHWRMDWDILPKGHRWENPLMGWQSSGDMMQGTKLNFKTKE… |
| A0A7W8LVX3 | 2-82 | None |
| V5IK22 | 27-185 | None |
| A0A368A5I5 | 2-82 | None |
| A0A7R9A7N9 | 632-762 | None |
| A0A0D8X956 | 32-167 | None |
| A0A6A7ZUD2 | 40-198 | None |
| A0A7R9PWG7 | 69-198 | None |
| A0A182FHE4 | 591-723 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.