DPCstruct | MC43033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 14.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 81.50 |
| Assigned Pfam label(s) | CL0408- PF14693- CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8EMZ7 | 91-194 | KILRLIAHDREKAGRLSANRARKDGFIPCAVFKQGEIEKTSEVCAVSEREVEKLLRKFTKYGLRTKLIDIVLDDGKRTVKAIPQQIQ… |
| A0DGI5 | 128-228 | KKVVLPAKRVRSLDDHIIGLWKQHEVAVVIEGRDEFEDIDIVLDYYQVAAVKRRICANVAPIYIRIPGHDGDIRCTLGEIIKDPKSG… |
| A0A3A0AVY4 | 4-99 | None |
| A0A7J6LPQ7 | 362-464 | None |
| A0A6V7PT10 | 381-494 | None |
| A0A6J7I124 | 3-95 | None |
| A0A6A6L6B2 | 58-172 | None |
| A0A7S3KF99 | 105-202 | None |
| A0A371JKK6 | 29-123 | None |
| A0A7S3N8T4 | 107-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.