DPCstruct | MC43031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 374 ± 43 aa |
| Standard deviation of domain lengths | 43.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.28 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0042- CL0336- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2AQB8 | 1-370 | MGPNARSVMQAIKRIDKLPELKTIAVGHGPLLHNQVNFWKGKYLEWSSNKSKGNDFVSVCYISDYGYCDRLSQAISHGISKADAQVQ… |
| R5EFC1 | 6-325 | LGYYLNLYDIWSSYRVESDGIVVAYTSVYGHTKAAAELLAQKLTDKGCPEVIVHDLARCDMAKAVEDAFRYGKLVLATTTYNADVFP… |
| A0A0W1DBX7 | 21-351 | None |
| A0A7S0CSV9 | 52-439 | None |
| A0A7J6YLS1 | 275-599 | None |
| A0A846A538 | 1-438 | None |
| A0A2W4WAC3 | 1-433 | None |
| A0A645AJW8 | 4-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.