DPCstruct | MC4303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 61 ± 2 aa |
| Standard deviation of domain lengths | 1.80 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 95.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 32.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2ZHI0 | 63-121 | LAFTYCQVPVVYRLSDERKIDLHLADGSTRTVEGWALDRESSAELFRRTGAIVRIEVSL |
| A0A7X6APT2 | 19-78 | LTVCQVPVVVSVTAGDPSIEVDFSDGRTTRRDGLRLGREISAMLFGRTGEVRLIRAALPP |
| A0A6L9IKB6 | 444-505 | None |
| A0A848ZKX3 | 222-280 | None |
| A0A833AR54 | 98-157 | None |
| A0A090T2K9 | 572-635 | None |
| A0A7Y3F972 | 670-733 | None |
| A0A7X5VQY4 | 108-168 | None |
| A0A849ELP3 | 802-861 | None |
| M5RQG6 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.