DPCstruct | MC43027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 250 ± 40 aa |
| Standard deviation of domain lengths | 39.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.63 |
| Pfam Score | 88.74 |
| Assigned Pfam label(s) | PF07837- PF02971 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6SC94 | 5-254 | IFLVRLEMDASYNRSVVTVIGEANAVIDKMVESAKIATELIDLRKHKGEHPRMGAVDVTPVLPIQNITEEECVELSKELGRKINIAT… |
| A0A6J7MZ80 | 2-183 | VPFCEIEGPMAIAVEAARAFGYWAGAELDLPVFFYDEADPEQRSLPVLRAQAFSSRAPDAGPNQPNPRLGAVAVGARRPLIAVNFFL… |
| H2P3H4 | 5-224 | None |
| A0A6A1V509 | 24-230 | None |
| A0A5N5GAR3 | 338-586 | None |
| A0A2Y9FZL4 | 17-254 | None |
| A0A251RKW3 | 193-459 | None |
| A0A397FDA0 | 13-273 | None |
| A0A2N9ISC6 | 87-357 | None |
| A0A803Q6B8 | 185-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.