DPCstruct | MC43020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6798 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 23.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 11.32 |
| Pfam Score | 85.22 |
| Assigned Pfam label(s) | PF08736- PF01412- CL0020- CL0330- PF00621 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2SVR3 | 17-137 | EVIQVMLPRGMAVEMRGPVLQLRGRGRILSKVWKTVWLSLTAYALVLRKGELEVSKLLAAVDLRQITAVEKSSNVRYGFLITSAANE… |
| A0A177VGZ4 | 782-907 | PVLAGWVYVEDRKKKWAKRWLELREHSLYHAKSEKGKDEVFICSLSTFDVYLVDTGKIKTPRPHAFAIRSQNSITMFEKPDQDYVHY… |
| A0A034VGE7 | 4-116 | None |
| A0A7S0LVA4 | 9-126 | None |
| A0A7S0LV29 | 52-190 | None |
| A0A1X6PLF2 | 9-101 | None |
| A0A1X6PHE8 | 30-136 | None |
| A0A7S1XY75 | 1-144 | None |
| A0A7S1UK28 | 23-195 | None |
| A0A7R9Q3Q8 | 271-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.