DPCstruct | MC4302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 251 ± 53 aa |
| Standard deviation of domain lengths | 53.23 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I6QEB3 | 184-385 | GKIVAWKQPAVMLSSCVDYHTGERGHQQHLVDVQFATRPEARLWVNHPGDVAPGSEARPSFWAGNGVLPRVMQVENQAMLLWQLDEC… |
| A0A7X5WMH5 | 59-331 | TYRTKDVMLSTALDHRPGVFGDQQHISQATLSENAVVFITHPKNEPFTGVDRFPDADGYWTGSGTLPRSAQVGATSIHLYTPAYAAP… |
| A0A8A4Z9A7 | 30-210 | None |
| A0A258KH48 | 16-323 | None |
| A0A7S2XK77 | 49-306 | None |
| A0A7V3AEC3 | 648-995 | None |
| A0A3C1RWD5 | 214-478 | None |
| A0A2P6NIA9 | 325-603 | None |
| A0A3E1EB53 | 58-339 | None |
| A0A2T0JZ82 | 299-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.